GRPEL2 anticorps

N° du produit ABIN630999

Détail du produit anti-GRPEL2 anticorps

Antigène: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GRPEL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GRPEL2 Blocking Peptide, catalog no. 33R-3717, is also available for use as a blocking control in assays to test for specificity of this GRPEL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRPEL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GRPEL2

Antigène: GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))

Autre désignation: GRPEL2 (GRPEL2 Produits)

Synonymes: anticorps mt-GrpE2, anticorps mt-Grpel2, anticorps Afap1l1, anticorps Mt-GrpE2, anticorps GrpE-like 2, mitochondrial, anticorps GrpE like 2, mitochondrial, anticorps Grpel2, anticorps GRPEL2

Sujet: GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Poids moléculaire: 25 kDa (MW of target protein)