ALAS1 anticorps (N-Term)

N° du produit ABIN631001

Détail du produit anti-ALAS1 anticorps

Antigène: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALAS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ALAS1 antibody was raised against the N terminal of ALAS1

Purification: Affinity purified

Immunogène: ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALAS1

Antigène: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Autre désignation: ALAS1 (ALAS1 Produits)

Synonymes: anticorps ALAS, anticorps ALAS3, anticorps ALASH, anticorps MIG4, anticorps ALAS-N, anticorps Alas-1, anticorps Alas-h, anticorps ALAS-H, anticorps ALASN, anticorps ALAS1, anticorps wu:fb58d01, anticorps wu:fi12g09, anticorps 5'-aminolevulinate synthase 1, anticorps aminolevulinic acid synthase 1, anticorps alanyl-tRNA synthetase protein, anticorps aminolevulinate, delta-, synthase 1, anticorps ALAS1, anticorps Alas1, anticorps alas1, anticorps alas1.S, anticorps alaS1

Sujet: Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha