Prohibitin 2 anticorps (N-Term)
-
- Antigène Voir toutes Prohibitin 2 (PHB2) Anticorps
- Prohibitin 2 (PHB2)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Prohibitin 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Prohibitin 2 antibody was raised against the N terminal of PHB2
- Purification
- Affinity purified
- Immunogène
- Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
- Top Product
- Discover our top product PHB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Prohibitin 2 Blocking Peptide, catalog no. 33R-9946, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Prohibitin 2 (PHB2)
- Autre désignation
- Prohibitin 2 (PHB2 Produits)
- Synonymes
- anticorps bcap37, anticorps zgc:73150, anticorps wu:fc28c08, anticorps PHB2, anticorps phb2, anticorps ATPHB2, anticorps F21M11.21, anticorps F21M11_21, anticorps prohibitin 2, anticorps DKFZp469N1310, anticorps BAP, anticorps BCAP37, anticorps Bap37, anticorps PNAS-141, anticorps REA, anticorps p22, anticorps bap37, anticorps prohibitin2, anticorps xphb2, anticorps AU044498, anticorps Bcap37, anticorps Bap, anticorps Bap-37, anticorps Bcap27, anticorps prohibitin 2a, anticorps prohibitin 2, anticorps prohibitin 2 S homeolog, anticorps phb2a, anticorps PHB2, anticorps phb2, anticorps phb2.S, anticorps Phb2
- Sujet
- PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-