SDHB anticorps
-
- Antigène Voir toutes SDHB Anticorps
- SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDHB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE
- Top Product
- Discover our top product SDHB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SDHB Blocking Peptide, catalog no. 33R-10234, is also available for use as a blocking control in assays to test for specificity of this SDHB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDHB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))
- Autre désignation
- SDHB (SDHB Produits)
- Synonymes
- anticorps succinate dehydrogenase 2-3, anticorps CG3283, anticorps Dmel\\CG3283, anticorps Ip, anticorps SDH, anticorps SDH-IP, anticorps SDH-Ip, anticorps SDHb, anticorps sdhB, anticorps CWS2, anticorps IP, anticorps PGL4, anticorps SDH1, anticorps SDH2, anticorps SDHIP, anticorps 0710008N11Rik, anticorps fj46d06, anticorps wu:fj46d06, anticorps succinate dehydrogenase complex iron sulfur subunit B, anticorps succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, anticorps Succinate dehydrogenase, subunit B (iron-sulfur), anticorps succinate dehydrogenase complex subunit B, iron sulfur (Ip), anticorps succinate dehydrogenase complex, subunit B, iron sulfur (Ip), anticorps succinate dehydrogenase complex subunit B, iron sulfur (Ip) S homeolog, anticorps SDHB, anticorps SDH2-3, anticorps SdhB, anticorps sdhb, anticorps Sdhb, anticorps sdhb.S
- Sujet
- Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
- Poids moléculaire
- 31 kDa (MW of target protein)
-