NT5M anticorps (N-Term)
-
- Antigène Voir toutes NT5M Anticorps
- NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NT5M est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NT5 M antibody was raised against the N terminal of NT5
- Purification
- Affinity purified
- Immunogène
- NT5 M antibody was raised using the N terminal of NT5 corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL
- Top Product
- Discover our top product NT5M Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NT5M Blocking Peptide, catalog no. 33R-1369, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))
- Autre désignation
- NT5M (NT5M Produits)
- Sujet
- This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Poids moléculaire
- 23 kDa (MW of target protein)
-