NT5M anticorps (N-Term)

N° du produit ABIN631013

Détail du produit anti-NT5M anticorps

Antigène: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5M est non-conjugé

Application: Western Blotting (WB)

Specificité: NT5 M antibody was raised against the N terminal of NT5

Purification: Affinity purified

Immunogène: NT5 M antibody was raised using the N terminal of NT5 corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5M Blocking Peptide, catalog no. 33R-1369, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5M

Antigène: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Autre désignation: NT5M (NT5M Produits)

Synonymes: anticorps NT5M, anticorps dNT-2, anticorps dNT2, anticorps mdN, anticorps 2010013E09Rik, anticorps AI846937, anticorps 5',3'-nucleotidase, mitochondrial, anticorps NT5M, anticorps Nt5m, anticorps nt5m

Sujet: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Poids moléculaire: 23 kDa (MW of target protein)