LACTB anticorps (C-Term)

N° du produit ABIN631015

Détail du produit anti-LACTB anticorps

Antigène: LACTB (Lactamase, beta (LACTB))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LACTB est non-conjugé

Application: Western Blotting (WB)

Specificité: Beta Lactamase antibody was raised against the C terminal of LACTB

Purification: Affinity purified

Immunogène: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LACTB

Antigène: LACTB (Lactamase, beta (LACTB))

Autre désignation: beta Lactamase (LACTB Produits)

Synonymes: anticorps BA2507, anticorps PSPTO2834, anticorps PSPTO3594, anticorps G24, anticorps MRPL56, anticorps LACT-1, anticorps Lact1, anticorps Mrpl56, anticorps zgc:110419, anticorps beta-lactamase, anticorps class C beta-lactamase AmpC, anticorps metal-dependent hydrolase, anticorps lactamase beta, anticorps Beta-lactamase, anticorps lactamase, beta, anticorps metallo-beta-lactamase domain containing 2, anticorps Beta lactamase, anticorps bla1, anticorps ampC, anticorps PSPTO_2834, anticorps GSU1378, anticorps MCA2220, anticorps CJE0344, anticorps LACTB, anticorps Rmar_1357, anticorps MGYG_07395, anticorps ML5_3452, anticorps bla, anticorps Lactb, anticorps lactb, anticorps MBLAC2, anticorps blaKPC-2

Sujet: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Poids moléculaire: 61 kDa (MW of target protein)