RPS3A anticorps (N-Term)

N° du produit ABIN631017

Détail du produit anti-RPS3A anticorps

Antigène: RPS3A (Ribosomal Protein S3A (RPS3A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS3A est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS3 A antibody was raised against the N terminal of RPS3

Purification: Affinity purified

Immunogène: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS3A Blocking Peptide, catalog no. 33R-1414, is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS3A

Antigène: RPS3A (Ribosomal Protein S3A (RPS3A))

Autre désignation: RPS3A (RPS3A Produits)

Synonymes: anticorps FTE1, anticorps MFTL, anticorps S3A, anticorps Rps3a, anticorps RPS3AE, anticorps fb02h01, anticorps rpS3Ae, anticorps wu:fb02h01, anticorps zgc:73195, anticorps zgc:86672, anticorps fte1, anticorps mftl, anticorps rps3a, anticorps C3, anticorps CG2168, anticorps Dmel\\CG2168, anticorps M(4)101, anticorps M(4)57g, anticorps M(4)[57g], anticorps M57g, anticorps M[57g], anticorps RPS3A, anticorps RPS3a, anticorps RpS3a, anticorps anon-EST:Liang-2.29, anticorps clone 2.29, anticorps l(4)102ABa, anticorps fte-1, anticorps ribosomal protein S3A, anticorps ribosomal protein S3A1, anticorps ribosomal protein S3a, anticorps ribosomal protein S3A L homeolog, anticorps ribosomal protein S3A S homeolog, anticorps Ribosomal protein S3A, anticorps 40S ribosomal protein S3a, anticorps 40S ribosomal protein S3A, anticorps RPS3A, anticorps Rps3a1, anticorps Rps3a, anticorps rps3a, anticorps rps3a.L, anticorps rps3a.S, anticorps RpS3A, anticorps rs3a, anticorps KRP-A

Sujet: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 30 kDa (MW of target protein)