WARS anticorps (N-Term)

N° du produit ABIN631021

Détail du produit anti-WARS anticorps

Antigène: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WARS est non-conjugé

Application: Western Blotting (WB)

Specificité: WARS antibody was raised against the N terminal of WARS

Purification: Affinity purified

Immunogène: WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WARS Blocking Peptide, catalog no. 33R-2465, is also available for use as a blocking control in assays to test for specificity of this WARS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WARS

Antigène: WARS (Tryptophanyl-tRNA Synthetase (WARS))

Autre désignation: WARS (WARS Produits)

Synonymes: anticorps GAMMA-2, anticorps IFI53, anticorps IFP53, anticorps zgc:73274, anticorps wars, anticorps MGC53671, anticorps WARS, anticorps TrpRS, anticorps WRS, anticorps 85D-WRS, anticorps CG9735, anticorps Dmel\\CG9735, anticorps WRS-85D, anticorps l(3)03559, anticorps l(3)03560, anticorps l(3)3559, anticorps gamma-2, anticorps ifi53, anticorps ifp53, anticorps GB14934, anticorps ECK3371, anticorps JW3347, anticorps tryptophanyl-tRNA synthetase, anticorps tryptophanyl-tRNA synthetase S homeolog, anticorps Tryptophanyl-tRNA synthetase, anticorps tryptophanyl-tRNA synthetase L homeolog, anticorps tryptophan--tRNA ligase, cytoplasmic, anticorps WARS, anticorps wars, anticorps wars.S, anticorps Wars, anticorps TrpRS, anticorps wars.L, anticorps LOC727582, anticorps trpS, anticorps trpS2

Sujet: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.

Poids moléculaire: 52 kDa (MW of target protein)