TCL1A anticorps (N-Term)
-
- Antigène Voir toutes TCL1A Anticorps
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TCL1A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TCL1 A antibody was raised against the N terminal of TCL1
- Purification
- Affinity purified
- Immunogène
- TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
- Top Product
- Discover our top product TCL1A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
- Autre désignation
- TCL1A (TCL1A Produits)
- Synonymes
- anticorps TCL1A, anticorps Tcl1a, anticorps TCL1, anticorps Tcl1, anticorps T-cell leukemia/lymphoma 1A, anticorps T cell lymphoma breakpoint 1, anticorps TCL1A, anticorps Tcl1, anticorps Tcl1a
- Sujet
- TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
- Poids moléculaire
- 13 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-