DLD anticorps (Middle Region)
-
- Antigène Voir toutes DLD Anticorps
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DLD antibody was raised against the middle region of DLD
- Purification
- Affinity purified
- Immunogène
- DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
- Top Product
- Discover our top product DLD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
- Autre désignation
- DLD (DLD Produits)
- Synonymes
- anticorps DLDD, anticorps DLDH, anticorps E3, anticorps GCSL, anticorps LAD, anticorps PHE3, anticorps AI315664, anticorps AI746344, anticorps wu:fb24b05, anticorps DLD, anticorps DDBDRAFT_0183800, anticorps DDBDRAFT_0216232, anticorps DDB_0183800, anticorps DDB_0216232, anticorps sc:d0402, anticorps dihydrolipoamide dehydrogenase, anticorps dihydrolipoyl dehydrogenase, anticorps deltaD, anticorps DLD, anticorps Dld, anticorps dldh, anticorps AT4G16155, anticorps CND05840, anticorps bfmBC, anticorps GCSL, anticorps LACBIDRAFT_182385, anticorps UREG_06178, anticorps lpd, anticorps TAGG_RS02070, anticorps Arnit_2606, anticorps Mesil_1945, anticorps Trad_2118, anticorps Acear_0640, anticorps Fbal_0372, anticorps Ilyop_1890, anticorps Ftrac_1733, anticorps Ocepr_1753, anticorps Intca_2017, anticorps Deima_0504, anticorps dld
- Sujet
- DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis
-