CYP27A1 anticorps (Middle Region)
-
- Antigène Voir toutes CYP27A1 Anticorps
- CYP27A1 (Cytochrome P450, Family 27, Subfamily A, Polypeptide 1 (CYP27A1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP27A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP27 A1 antibody was raised against the middle region of CYP27 1
- Purification
- Affinity purified
- Immunogène
- CYP27 A1 antibody was raised using the middle region of CYP27 1 corresponding to a region with amino acids SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI
- Top Product
- Discover our top product CYP27A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP27A1 Blocking Peptide, catalog no. 33R-8744, is also available for use as a blocking control in assays to test for specificity of this CYP27A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP27A1 (Cytochrome P450, Family 27, Subfamily A, Polypeptide 1 (CYP27A1))
- Autre désignation
- CYP27A1 (CYP27A1 Produits)
- Synonymes
- anticorps CP27, anticorps CTX, anticorps CYP27, anticorps Cyp27, anticorps P450C27, anticorps 1300013A03Rik, anticorps cytochrome P450 family 27 subfamily A member 1, anticorps cytochrome P450, family 27, subfamily a, polypeptide 1, anticorps cytochrome P450, family 27, subfamily A, polypeptide 1, anticorps sterol 26-hydroxylase, mitochondrial, anticorps CYP27A1, anticorps Cyp27a1, anticorps cyp27a1
- Sujet
- CYP27A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease.
- Poids moléculaire
- 57 kDa (MW of target protein)
-