P5CS anticorps (N-Term)
-
- Antigène Voir toutes P5CS (ALDH18A1) Anticorps
- P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp P5CS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDH18 A1 antibody was raised against the N terminal of ALDH18 1
- Purification
- Affinity purified
- Immunogène
- ALDH18 A1 antibody was raised using the N terminal of ALDH18 1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
- Top Product
- Discover our top product ALDH18A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDH18A1 Blocking Peptide, catalog no. 33R-8914, is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))
- Autre désignation
- ALDH18A1 (ALDH18A1 Produits)
- Synonymes
- anticorps ALDH18A1, anticorps ARCL3A, anticorps GSAS, anticorps P5CS, anticorps PYCS, anticorps 2810433K04Rik, anticorps AI429789, anticorps Pycs, anticorps cb842, anticorps cb899, anticorps pycs, anticorps sb:cb881, anticorps wu:fa91f10, anticorps wu:fi05f11, anticorps wu:fi17d12, anticorps aldehyde dehydrogenase 18 family member A1, anticorps aldehyde dehydrogenase 18 family, member A1, anticorps aldehyde dehydrogenase 18 family member A1 L homeolog, anticorps ALDH18A1, anticorps aldh18a1, anticorps Aldh18a1, anticorps aldh18a1.L
- Sujet
- This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.
- Poids moléculaire
- 87 kDa (MW of target protein)
-