PDK3 anticorps (Middle Region)
-
- Antigène Voir toutes PDK3 Anticorps
- PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDK3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PDK3 antibody was raised against the middle region of PDK3
- Purification
- Affinity purified
- Immunogène
- PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK
- Top Product
- Discover our top product PDK3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDK3 (Pyruvate Dehydrogenase Kinase, Isozyme 3 (PDK3))
- Autre désignation
- PDK3 (PDK3 Produits)
- Synonymes
- anticorps pdk3, anticorps PDK3, anticorps 2610001M10Rik, anticorps AI035637, anticorps zgc:158702, anticorps pyruvate dehydrogenase kinase 3, anticorps pyruvate dehydrogenase kinase, isozyme 3a, anticorps pyruvate dehydrogenase kinase, isoenzyme 3, anticorps fragile site, 5-azacytidine type, common, fra(1)(q12), anticorps pyruvate dehydrogenase kinase, isozyme 3b, anticorps PDK3, anticorps Pdk3, anticorps pdk3a, anticorps pdk3, anticorps FRA1J, anticorps pdk3b
- Sujet
- PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
- Poids moléculaire
- 47 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, L'effet Warburg
-