TRMU anticorps (C-Term)

N° du produit ABIN631035

Détail du produit anti-TRMU anticorps

Antigène: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRMU est non-conjugé

Application: Western Blotting (WB)

Specificité: TRMU antibody was raised against the C terminal of TRMU

Purification: Affinity purified

Immunogène: TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRMU Blocking Peptide, catalog no. 33R-1321, is also available for use as a blocking control in assays to test for specificity of this TRMU antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRMU

Antigène: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Autre désignation: TRMU (TRMU Produits)

Synonymes: anticorps MTO2, anticorps MTU1, anticorps TRMT, anticorps TRMT1, anticorps TRNT1, anticorps 1110005N20Rik, anticorps 1600025P05Rik, anticorps AI314320, anticorps Trmt1, anticorps zgc:110555, anticorps tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase, anticorps TRMU, anticorps Trmu, anticorps trmu

Sujet: TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Poids moléculaire: 48 kDa (MW of target protein)