Kallikrein 6 anticorps (N-Term)
-
- Antigène Voir toutes Kallikrein 6 (KLK6) Anticorps
- Kallikrein 6 (KLK6)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Kallikrein 6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLK6 antibody was raised against the N terminal of KLK6
- Purification
- Affinity purified
- Immunogène
- KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
- Top Product
- Discover our top product KLK6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLK6 Blocking Peptide, catalog no. 33R-4416, is also available for use as a blocking control in assays to test for specificity of this KLK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Kallikrein 6 (KLK6)
- Autre désignation
- KLK6 (KLK6 Produits)
- Synonymes
- anticorps Bssp, anticorps Klk7, anticorps PRSS18, anticorps PRSS9, anticorps SP59, anticorps hK6, anticorps Prss9, anticorps AI849898, anticorps BSP, anticorps Klk29, anticorps MSP, anticorps Prss18, anticorps neurosin, anticorps kallikrein related peptidase 6, anticorps kallikrein related-peptidase 6, anticorps kallikrein-6, anticorps KLK6, anticorps Klk6, anticorps LOC100716801
- Sujet
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.
- Poids moléculaire
- 25 kDa (MW of target protein)
- Pathways
- Système du Complément, Regulation of G-Protein Coupled Receptor Protein Signaling
-