GLYAT anticorps (N-Term)

N° du produit ABIN631040

Détail du produit anti-GLYAT anticorps

Antigène: GLYAT (Glycine N-Acyltransferase (GLYAT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLYAT est non-conjugé

Application: Western Blotting (WB)

Specificité: GLYAT antibody was raised against the N terminal of GLYAT

Purification: Affinity purified

Immunogène: GLYAT antibody was raised using the N terminal of GLYAT corresponding to a region with amino acids HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLYAT Blocking Peptide, catalog no. 33R-3880, is also available for use as a blocking control in assays to test for specificity of this GLYAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLYAT

Antigène: GLYAT (Glycine N-Acyltransferase (GLYAT))

Autre désignation: GLYAT (GLYAT Produits)

Synonymes: anticorps ACGNAT, anticorps CAT, anticorps GAT, anticorps A330009E03Rik, anticorps AI195249, anticorps AI315345, anticorps glycine-N-acyltransferase, anticorps GLYAT, anticorps Glyat

Sujet: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's.

Poids moléculaire: 34 kDa (MW of target protein)