ISCA2 anticorps

N° du produit ABIN631044

Détail du produit anti-ISCA2 anticorps

Antigène: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ISCA2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ISCA2 Blocking Peptide, catalog no. 33R-8133, is also available for use as a blocking control in assays to test for specificity of this ISCA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISCA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ISCA2

Antigène: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Autre désignation: ISCA2 (ISCA2 Produits)

Synonymes: anticorps HBLD1, anticorps ISA2, anticorps c14_5557, anticorps Hbld1, anticorps RGD1563216, anticorps 0710001C05Rik, anticorps 5730594E03Rik, anticorps iron-sulfur cluster assembly 2, anticorps ISCA2, anticorps Isca2

Sujet: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Poids moléculaire: 16 kDa (MW of target protein)