PCK1 anticorps (Soluble)
-
- Antigène Voir toutes PCK1 Anticorps
- PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
-
Épitope
- Soluble
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
- Top Product
- Discover our top product PCK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.6 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))
- Autre désignation
- PCK1 (PCK1 Produits)
- Synonymes
- anticorps PEPCK-C, anticorps PEPCK1, anticorps PEPCKC, anticorps PEPCK, anticorps PEPCK-M, anticorps PEPCK2, anticorps 1810010O14Rik, anticorps 9130022B02Rik, anticorps cb856, anticorps cb924, anticorps fj93h11, anticorps zgc:63869, anticorps wu:fc51c05, anticorps wu:fj93h11, anticorps pepck-c, anticorps pepck1, anticorps pepckc, anticorps PCK1, anticorps PPCK1, anticorps AI265463, anticorps Pck-1, anticorps GTP, anticorps PCK, anticorps Pepck, anticorps RATPEPCK, anticorps Ppc1C, anticorps PHOSPHOENOLPYRUVATE CARBOXYKINASE, anticorps T28I19.150, anticorps T28I19_150, anticorps phosphoenolpyruvate carboxykinase 1, anticorps 143299_at, anticorps CG10924, anticorps CG17725, anticorps Dmel\\CG17725, anticorps Dromel_CG17725_FBtr0086701_pepck_mORF, anticorps dPEPCK, anticorps pepck, anticorps PEPC, anticorps PEPCase, anticorps ppc, anticorps phosphoenolpyruvate carboxykinase 1, anticorps phosphoenolpyruvate carboxykinase 2, mitochondrial, anticorps phosphoenolpyruvate carboxykinase 2 (mitochondrial), anticorps phosphoenolpyruvate carboxykinase 1 (soluble), anticorps phosphoenolpyruvate carboxykinase 1 S homeolog, anticorps phosphoenolpyruvate carboxykinase, cytosolic [GTP], anticorps phosphoenolpyruvate carboxykinase 1, cytosolic, anticorps phosphoenolpyruvate carboxylase 7, anticorps Phosphoenolpyruvate carboxykinase, anticorps phosphoenolpyruvate carboxylase, anticorps PCK1, anticorps PCK2, anticorps Pck2, anticorps pck1, anticorps pck1.S, anticorps LOC100634531, anticorps Pck1, anticorps pep7, anticorps Pepck, anticorps LOC107777405
- Sujet
- PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.
- Poids moléculaire
- 69 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis
-