LRP1 anticorps
-
- Antigène Voir toutes LRP1 Anticorps
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
- Top Product
- Discover our top product LRP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRP1 Blocking Peptide, catalog no. 33R-1577, is also available for use as a blocking control in assays to test for specificity of this LRP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
- Autre désignation
- LRP1 (LRP1 Produits)
- Synonymes
- anticorps A2MR, anticorps APOER, anticorps APR, anticorps CD91, anticorps IGFBP3R, anticorps LRP, anticorps LRP1A, anticorps TGFBR5, anticorps A2mr, anticorps AI316852, anticorps Lrp, anticorps LRP-1, anticorps LDL receptor related protein 1, anticorps prolow-density lipoprotein receptor-related protein 1, anticorps low density lipoprotein receptor-related protein 1, anticorps LRP1, anticorps Lrp1, anticorps LOC100414789
- Sujet
- Low-density lipoprotein receptor-related protein 1 (-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-