ALAS2 anticorps (N-Term)

N° du produit ABIN631054

Détail du produit anti-ALAS2 anticorps

Antigène: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALAS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ALAS2 antibody was raised against the N terminal of ALAS2

Purification: Affinity purified

Immunogène: ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALAS2 Blocking Peptide, catalog no. 33R-1765, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALAS2

Antigène: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Autre désignation: ALAS2 (ALAS2 Produits)

Synonymes: anticorps anh1, anticorps asb, anticorps xlsa, anticorps ALAS-E, anticorps ALASE, anticorps ANH1, anticorps ASB, anticorps XLDPP, anticorps XLEPP, anticorps XLSA, anticorps alas-e, anticorps cb1063, anticorps sau, anticorps sauternes, anticorps ALAS, anticorps Alas-2, anticorps 5'-aminolevulinate synthase 2, anticorps aminolevulinate, delta-, synthase 2, anticorps aminolevulinic acid synthase 2, erythroid, anticorps alas2, anticorps ALAS2, anticorps Alas2, anticorps alas2.L

Sujet: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis