HADH anticorps (C-Term)

N° du produit ABIN631059

Détail du produit anti-HADH anticorps

Antigène: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HADH est non-conjugé

Application: Western Blotting (WB)

Specificité: HADH antibody was raised against the C terminal of HADH

Purification: Affinity purified

Immunogène: HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HADH Blocking Peptide, catalog no. 33R-10203, is also available for use as a blocking control in assays to test for specificity of this HADH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HADH

Antigène: HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))

Autre désignation: HADH (HADH Produits)

Sujet: HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Monocarboxylic Acid Catabolic Process