VPS28 anticorps

N° du produit ABIN631062

Détail du produit anti-VPS28 anticorps

Antigène: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VPS28 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VPS28 Blocking Peptide, catalog no. 33R-5993, is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VPS28

Antigène: VPS28 (Vacuolar Protein Sorting 28 (VPS28))

Autre désignation: VPS28 (VPS28 Produits)

Synonymes: anticorps CG12770, anticorps DmVps28, anticorps Dmel\\CG12770, anticorps Dvps28, anticorps ESCRT-I, anticorps ESCRT-II, anticorps dVps28, anticorps dvps28, anticorps l(2)k16503, anticorps vps28, anticorps VPS28, anticorps GB12925, anticorps VPL13, anticorps VPT28, anticorps DDBDRAFT_0186436, anticorps DDBDRAFT_0234023, anticorps DDB_0186436, anticorps DDB_0234023, anticorps 1110014J03Rik, anticorps AI847241, anticorps D730005C08Rik, anticorps zgc:66078, anticorps Vacuolar protein sorting 28, anticorps VPS28, ESCRT-I subunit, anticorps vacuolar protein sorting 28 homolog, anticorps vacuolar protein sorting-associated protein 28 homolog, anticorps ESCRT-I subunit protein VPS28, anticorps ESCRT I complex subunit Vps28, anticorps transport of soluble vacuolar hydrolase precursors, anticorps subunit of the ESCRT-I complex, anticorps vacuolar protein sorting-associated protein, anticorps vacuolar protein sorting 28 family protein, anticorps vacuolar protein sorting-associated protein 28, anticorps Vacuolar protein sorting-associated protein 28 homolog, anticorps vacuolar protein sorting 28, anticorps vacuolar protein sorting 28 (yeast), anticorps vacuolar protein sorting 28 homolog S homeolog, anticorps Vps28, anticorps VPS28, anticorps vps28, anticorps LOC408783, anticorps CpipJ_CPIJ003920, anticorps LACBIDRAFT_399656, anticorps PTRG_04781, anticorps MCYG_00028, anticorps PITG_04534, anticorps Tsp_08691, anticorps Tsp_08687, anticorps Tsp_08688, anticorps vps-28, anticorps vps28.S

Sujet: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.

Poids moléculaire: 25 kDa (MW of target protein)