Catenin anticorps

N° du produit ABIN631064

Détail du produit anti-Catenin anticorps

Antigène: Catenin

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Catenin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Catenin Blocking Peptide, catalog no. 33R-7753, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Catenin

Antigène: Catenin

Abstract: Catenin Produits

Synonymes: anticorps Bfc, anticorps Catnb, anticorps Mesc, anticorps CTNNB, anticorps MRD19, anticorps armadillo, anticorps catenin (cadherin associated protein), beta 1, anticorps catenin beta 1, anticorps Ctnnb1, anticorps CTNNB1

Sujet: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined.

Poids moléculaire: 108 kDa (MW of target protein)