ACAA2 anticorps (N-Term)

N° du produit ABIN631066

Détail du produit anti-ACAA2 anticorps

Antigène: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACAA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACAA2 antibody was raised against the N terminal of ACAA2

Purification: Affinity purified

Immunogène: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACAA2 Blocking Peptide, catalog no. 33R-1355, is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACAA2

Antigène: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Autre désignation: ACAA2 (ACAA2 Produits)

Synonymes: anticorps DSAEC, anticorps fb59b11, anticorps zgc:56036, anticorps wu:fb59b11, anticorps 0610011L04Rik, anticorps AI255831, anticorps AI265397, anticorps D18Ertd240e, anticorps acetyl-CoA acyltransferase 2, anticorps acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase), anticorps acetyl-CoA acyltransferase 2 L homeolog, anticorps ACAA2, anticorps Acaa2, anticorps acaa2, anticorps acaa2.L

Sujet: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process