Catenin anticorps
-
- Antigène Tous les produits Catenin
- Catenin
- Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Catenin est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Catenin Blocking Peptide, catalog no. 33R-10205, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Catenin
- Abstract
- Catenin Produits
- Synonymes
- anticorps Bfc, anticorps Catnb, anticorps Mesc, anticorps CTNNB, anticorps MRD19, anticorps armadillo, anticorps catenin (cadherin associated protein), beta 1, anticorps catenin beta 1, anticorps Ctnnb1, anticorps CTNNB1
- Sujet
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated.
- Poids moléculaire
- 93 kDa (MW of target protein)
-