MTRF1L anticorps (N-Term)
-
- Antigène Voir toutes MTRF1L Anticorps
- MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MTRF1L est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MTRF1 L antibody was raised against the N terminal of MTRF1
- Purification
- Affinity purified
- Immunogène
- MTRF1 L antibody was raised using the N terminal of MTRF1 corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL
- Top Product
- Discover our top product MTRF1L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MTRF1L Blocking Peptide, catalog no. 33R-2544, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))
- Autre désignation
- MTRF1L (MTRF1L Produits)
- Synonymes
- anticorps fj59e12, anticorps wu:fj59e12, anticorps si:dkeyp-9b4.2, anticorps HMRF1L, anticorps MRF1L, anticorps mtRF1a, anticorps 9130004K12Rik, anticorps mitochondrial translational release factor 1 like, anticorps mitochondrial translational release factor 1-like, anticorps MTRF1L, anticorps mtrf1l, anticorps Mtrf1l
- Sujet
- MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.
- Poids moléculaire
- 30 kDa (MW of target protein)
-