FBXO31 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO31 Anticorps
- FBXO31 (F-Box Protein 31 (FBXO31))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO31 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO31 antibody was raised against the middle region of FBXO31
- Purification
- Affinity purified
- Immunogène
- FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS
- Top Product
- Discover our top product FBXO31 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO31 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO31 (F-Box Protein 31 (FBXO31))
- Autre désignation
- FBXO31 (FBXO31 Produits)
- Synonymes
- anticorps 1110003O08Rik, anticorps 2310046N15Rik, anticorps Fbx14, anticorps Fbxo14, anticorps FBX14, anticorps FBXO14, anticorps Fbx31, anticorps pp2386, anticorps RGD1561069, anticorps fbx14, anticorps fbx31, anticorps fbxo14, anticorps fbxo31, anticorps F-box protein 31, anticorps F-box protein 31 S homeolog, anticorps F-box protein 31 L homeolog, anticorps Fbxo31, anticorps FBXO31, anticorps fbxo31, anticorps fbxo31.S, anticorps fbxo31.L
- Sujet
- FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.
- Poids moléculaire
- 40 kDa (MW of target protein)
-