DLAT anticorps (C-Term)

N° du produit ABIN631076

Détail du produit anti-DLAT anticorps

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLAT est non-conjugé

Application: Western Blotting (WB)

Specificité: DLAT antibody was raised against the C terminal of DLAT

Purification: Affinity purified

Immunogène: DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLAT Blocking Peptide, catalog no. 33R-2227, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLAT

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Autre désignation: DLAT (DLAT Produits)

Synonymes: anticorps DLAT, anticorps Dmel\\CG5261, anticorps EP(2)0816, anticorps EP816, anticorps anon-WO0118547.121, anticorps DLTA, anticorps PDC-E2, anticorps PDCE2, anticorps wu:fc14f10, anticorps wu:fc21f08, anticorps wu:fc86g11, anticorps wu:fj57d06, anticorps 6332404G05Rik, anticorps midline uncoordinated, anticorps dihydrolipoamide S-acetyltransferase L homeolog, anticorps dihydrolipoamide S-acetyltransferase, anticorps dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex), anticorps muc, anticorps dlat.L, anticorps DLAT, anticorps Dlat, anticorps dlat

Sujet: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Poids moléculaire: 69 kDa (MW of target protein)