NDUFA9 anticorps
-
- Antigène Voir toutes NDUFA9 Anticorps
- NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDUFA9 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY
- Top Product
- Discover our top product NDUFA9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFA9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))
- Autre désignation
- NDUFA9 (NDUFA9 Produits)
- Synonymes
- anticorps ndufs2l, anticorps wu:fc41f12, anticorps zgc:112513, anticorps GB10406, anticorps NDUFA9, anticorps DDBDRAFT_0203708, anticorps DDBDRAFT_0302549, anticorps DDB_0203708, anticorps DDB_0302549, anticorps 1010001N11Rik, anticorps CC6, anticorps CI-39k, anticorps CI39k, anticorps NDUFS2L, anticorps SDR22E1, anticorps NADH:ubiquinone oxidoreductase subunit A9, anticorps NADH:ubiquinone oxidoreductase subunit A9 L homeolog, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9a, anticorps NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, anticorps NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, anticorps NDUFA9, anticorps ndufa9.L, anticorps ndufa9, anticorps ndufa9a, anticorps LOC551866, anticorps Ndufa9
- Sujet
- The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.
- Poids moléculaire
- 42 kDa (MW of target protein)
-