PCCA anticorps (N-Term)

N° du produit ABIN631082

Détail du produit anti-PCCA anticorps

Antigène: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCCA est non-conjugé

Application: Western Blotting (WB)

Specificité: PCCA antibody was raised against the N terminal of PCCA

Purification: Affinity purified

Immunogène: PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCCA Blocking Peptide, catalog no. 33R-5579, is also available for use as a blocking control in assays to test for specificity of this PCCA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCCA

Antigène: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Autre désignation: PCCA (PCCA Produits)

Synonymes: anticorps pcca, anticorps zgc:66359, anticorps C79630, anticorps wu:fb92g02, anticorps zgc:100925, anticorps propionyl-CoA carboxylase alpha subunit, anticorps propionyl-COA carboxylase alpha chain, mitochondrial, anticorps propionyl-CoA carboxylase alpha chain, anticorps zinc finger CCCH-type containing 13, anticorps propionyl-Coenzyme A carboxylase, alpha polypeptide, anticorps propionyl CoA carboxylase, alpha polypeptide, anticorps propionyl-CoA carboxylase alpha subunit L homeolog, anticorps PCCA, anticorps Pcca, anticorps BMEI0800, anticorps pccA, anticorps NRI_0781, anticorps zc3h13, anticorps pcca, anticorps pcca.L

Sujet: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Poids moléculaire: 75 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process