NAD-ME anticorps

N° du produit ABIN631085

Détail du produit anti-NAD-ME anticorps

Antigène: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAD-ME est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ME2 Blocking Peptide, catalog no. 33R-5654, is also available for use as a blocking control in assays to test for specificity of this ME2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAD-ME

Antigène: NAD-ME (NAD Dependent Malate Dehydrogenase (NAD-ME))

Autre désignation: ME2 (NAD-ME Produits)

Synonymes: anticorps ODS1, anticorps AW120568, anticorps D030040L20Rik, anticorps NAD-ME, anticorps zgc:100941, anticorps malic enzyme 2, anticorps malic enzyme 2, NAD(+)-dependent, mitochondrial, anticorps malic enzyme 2, NAD(+)-dependent, mitochondrial S homeolog, anticorps ME2, anticorps Me2, anticorps me2.S, anticorps me2

Sujet: ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.

Poids moléculaire: 65 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response