Aminomethyltransferase anticorps (N-Term)

N° du produit ABIN631086

Détail du produit anti-Aminomethyltransferase anticorps

Antigène: Aminomethyltransferase (AMT)

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aminomethyltransferase est non-conjugé

Application: Western Blotting (WB)

Specificité: AMT antibody was raised against the N terminal of AMT

Purification: Affinity purified

Immunogène: AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMT Blocking Peptide, catalog no. 33R-7703, is also available for use as a blocking control in assays to test for specificity of this AMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Aminomethyltransferase

Antigène: Aminomethyltransferase (AMT)

Autre désignation: AMT (AMT Produits)

Synonymes: anticorps F16J13.200, anticorps F16J13_200, anticorps T7P1.13, anticorps T7P1_13, anticorps wu:fc31f04, anticorps wu:fd44b12, anticorps wu:fd54h12, anticorps zgc:103483, anticorps zgc:109741, anticorps GCE, anticorps GCST, anticorps GCVT, anticorps NKH, anticorps EG434437, anticorps aminomethyltransferase, anticorps Glycine cleavage T-protein family, anticorps Aminomethyltransferase, anticorps aminomethyltransferase L homeolog, anticorps AMT, anticorps AT4G12130, anticorps AT1G60990, anticorps Tb11.01.1440, anticorps Palpr_0614, anticorps Ocepr_1643, anticorps Celal_2914, anticorps Deima_1002, anticorps Deipr_1956, anticorps Bacsa_3405, anticorps Celly_0288, anticorps Weevi_0527, anticorps Fluta_3952, anticorps Marky_0785, anticorps Spico_1217, anticorps Poras_1228, anticorps Halhy_3617, anticorps amt, anticorps amt.L, anticorps Amt

Sujet: The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.

Poids moléculaire: 44 kDa (MW of target protein)