Cytochrome C1 anticorps (Middle Region)
-
- Antigène Voir toutes Cytochrome C1 (CYC1) Anticorps
- Cytochrome C1 (CYC1)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cytochrome C1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYC1 antibody was raised against the middle region of CYC1
- Purification
- Affinity purified
- Immunogène
- CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP
- Top Product
- Discover our top product CYC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYC1 Blocking Peptide, catalog no. 33R-8262, is also available for use as a blocking control in assays to test for specificity of this CYC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cytochrome C1 (CYC1)
- Autre désignation
- CYC1 (CYC1 Produits)
- Synonymes
- anticorps DDBDRAFT_0184465, anticorps DDBDRAFT_0238603, anticorps DDB_0184465, anticorps DDB_0238603, anticorps UQCR4, anticorps 2610002H19Rik, anticorps AA408921, anticorps fb80h03, anticorps im:6911272, anticorps sr:nyz104, anticorps wu:fb80h03, anticorps zgc:123089, anticorps cytochrome c1, anticorps cytochrome c-1, anticorps cytochrome c-1 L homeolog, anticorps Sputw3181_0667, anticorps Shal_3628, anticorps Mpop_2472, anticorps Hneap_1140, anticorps cyc1, anticorps Bresu_2679, anticorps Fbal_3419, anticorps Sulku_2312, anticorps LOC100127128, anticorps ZMO0958, anticorps Rsph17029_0061, anticorps Mesop_2273, anticorps CYC1, anticorps Cyc1, anticorps cyc1.L
- Sujet
- CYC1 is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
- Poids moléculaire
- 35 kDa (MW of target protein)
-