KLC3 anticorps (Middle Region)
-
- Antigène Voir toutes KLC3 Anticorps
- KLC3 (Kinesin Light Chain 3 (KLC3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KLC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KLC3 antibody was raised against the middle region of KLC3
- Purification
- Affinity purified
- Immunogène
- KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
- Top Product
- Discover our top product KLC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KLC3 Blocking Peptide, catalog no. 33R-6199, is also available for use as a blocking control in assays to test for specificity of this KLC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KLC3 (Kinesin Light Chain 3 (KLC3))
- Autre désignation
- KLC3 (KLC3 Produits)
- Synonymes
- anticorps wu:fk22d07, anticorps zgc:153164, anticorps KLC2, anticorps KLC2L, anticorps KLCt, anticorps KNS2B, anticorps BC017147, anticorps Klct, anticorps kinesin light chain 3, anticorps KLC3, anticorps klc3, anticorps PTRG_03762, anticorps PTRG_11380, anticorps PTRG_11942, anticorps Klc3
- Sujet
- KLC3 is a member of the kinesin light chain gene family. Kinesins are molecular motors involved in the transport of cargo along microtubules, and are composed of two kinesin heavy chain (KHC) and two kinesin light chain (KLC) molecules. KLCs are thought to typically be involved in binding cargo and regulating kinesin activity. In the rat, a protein similar to this gene product is expressed in post-meiotic spermatids, where it associates with structural components of sperm tails and mitochondria.
- Poids moléculaire
- 55 kDa (MW of target protein)
-