GLYATL2 anticorps (Middle Region)
-
- Antigène Voir toutes GLYATL2 Anticorps
- GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLYATL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLYATL2 antibody was raised against the middle region of GLYATL2
- Purification
- Affinity purified
- Immunogène
- GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
- Top Product
- Discover our top product GLYATL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLYATL2 Blocking Peptide, catalog no. 33R-4843, is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYATL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))
- Autre désignation
- GLYATL2 (GLYATL2 Produits)
- Synonymes
- anticorps BXMAS2-10, anticorps GATF-B, anticorps glycine-N-acyltransferase like 2, anticorps GLYATL2
- Sujet
- GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.
- Poids moléculaire
- 34 kDa (MW of target protein)
-