CHCHD4 anticorps (N-Term)

N° du produit ABIN631099

Détail du produit anti-CHCHD4 anticorps

Antigène: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHCHD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CHCHD4 antibody was raised against the N terminal of CHCHD4

Purification: Affinity purified

Immunogène: CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHCHD4 Blocking Peptide, catalog no. 33R-6527, is also available for use as a blocking control in assays to test for specificity of this CHCHD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHCHD4

Antigène: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Autre désignation: CHCHD4 (CHCHD4 Produits)

Synonymes: anticorps 2410012P20Rik, anticorps 2810014D17Rik, anticorps AI838740, anticorps MIA40, anticorps TIMM40, anticorps mia40, anticorps timm40, anticorps chchd4, anticorps chchd4a, anticorps fc10g04, anticorps wu:fc10g04, anticorps zgc:100849, anticorps si:dkey-202e22.1, anticorps chchd4b, anticorps CaO19.2977, anticorps coiled-coil-helix-coiled-coil-helix domain containing 4, anticorps coiled-coil-helix-coiled-coil-helix domain containing 4 L homeolog, anticorps coiled-coil-helix-coiled-coil-helix domain containing 4a, anticorps coiled-coil-helix-coiled-coil-helix domain containing 4 S homeolog, anticorps Mia40p, anticorps Chchd4, anticorps CHCHD4, anticorps chchd4, anticorps chchd4.L, anticorps chchd4a, anticorps chchd4.S, anticorps LOC100361898, anticorps MIA40

Sujet: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.

Poids moléculaire: 16 kDa (MW of target protein)