SPATA5 anticorps (Middle Region)

N° du produit ABIN631101

Détail du produit anti-SPATA5 anticorps

Antigène: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA5 antibody was raised against the middle region of SPATA5

Purification: Affinity purified

Immunogène: SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA5 Blocking Peptide, catalog no. 33R-1347, is also available for use as a blocking control in assays to test for specificity of this SPATA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA5

Antigène: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Autre désignation: SPATA5 (SPATA5 Produits)

Synonymes: anticorps AFG2, anticorps SPAF, anticorps 2510048F20Rik, anticorps C78064, anticorps Spaf, anticorps spermatogenesis associated 5, anticorps SPATA5, anticorps Spata5

Sujet: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.

Poids moléculaire: 98 kDa (MW of target protein)