ACADSB anticorps (Middle Region)
-
- Antigène Voir toutes ACADSB Anticorps
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACADSB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACADSB antibody was raised against the middle region of ACADSB
- Purification
- Affinity purified
- Immunogène
- ACADSB antibody was raised using the middle region of ACADSB corresponding to a region with amino acids GLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLNEGRIGIAAQMLG
- Top Product
- Discover our top product ACADSB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACADSB Blocking Peptide, catalog no. 33R-3416, is also available for use as a blocking control in assays to test for specificity of this ACADSB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADSB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACADSB (Acyl-CoA Dehydrogenase, Short/branched Chain (ACADSB))
- Autre désignation
- ACADSB (ACADSB Produits)
- Synonymes
- anticorps 2-mebcad, anticorps acad7, anticorps sbcad, anticorps DDBDRAFT_0185291, anticorps DDBDRAFT_0237707, anticorps DDB_0185291, anticorps DDB_0237707, anticorps 2-MEBCAD, anticorps ACAD7, anticorps SBCAD, anticorps 1300003O09Rik, anticorps BB066609, anticorps acyl-CoA dehydrogenase, short/branched chain, anticorps acyl-CoA dehydrogenase short/branched chain, anticorps acyl-coenzyme A dehydrogenase, short/branched chain, anticorps acyl-CoA dehydrogenase, anticorps acyl-CoA dehydrogenase, short/branched chain L homeolog, anticorps acyl-Coenzyme A dehydrogenase, short/branched chain, anticorps ACADSB, anticorps acadsb, anticorps sce1166, anticorps acadsb.L, anticorps Acadsb
- Sujet
- Short/branched chain acyl-CoA dehydrogenase(ACADSB) is a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. Substrate specificity is the primary characteristic used to define members of this gene family. ACADSB has the greatest activity towards the short branched chain acyl-CoA derivative, (S)-2-methylbutyryl-CoA, but also reacts significantly with other 2-methyl branched chain substrates and with short straight chain acyl-CoAs.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-