RPS21 anticorps (N-Term)

N° du produit ABIN631108

Détail du produit anti-RPS21 anticorps

Antigène: RPS21 (Ribosomal Protein S21 (RPS21))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS21 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS21 antibody was raised against the N terminal of RPS21

Purification: Affinity purified

Immunogène: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS21 Blocking Peptide, catalog no. 33R-6335, is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS21

Antigène: RPS21 (Ribosomal Protein S21 (RPS21))

Autre désignation: RPS21 (RPS21 Produits)

Synonymes: anticorps CG2986, anticorps Dmel\\CG2986, anticorps M(2)23B, anticorps l(2)03575, anticorps l(2)168/14, anticorps l(2)k16814, anticorps oho23, anticorps oho23B, anticorps rpS21, anticorps RPS21, anticorps S21, anticorps 1810049N11Rik, anticorps 2410030A14Rik, anticorps zgc:56642, anticorps zgc:86816, anticorps Ribosomal protein S21, anticorps 40S ribosomal protein S21, anticorps ribosomal protein S21, anticorps ribosomal protein S21 S homeolog, anticorps RpS21, anticorps rps21b, anticorps rps-21, anticorps RPS21, anticorps Rps21, anticorps rps21, anticorps rps21.S

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 9 kDa (MW of target protein)