RNF207 anticorps (N-Term)

N° du produit ABIN631110

Détail du produit anti-RNF207 anticorps

Antigène: RNF207 (RING Finger Protein 207 (RNF207))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF207 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF207 antibody was raised against the N terminal of RNF207

Purification: Affinity purified

Immunogène: RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF207 Blocking Peptide, catalog no. 33R-1739, is also available for use as a blocking control in assays to test for specificity of this RNF207 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF207 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF207

Antigène: RNF207 (RING Finger Protein 207 (RNF207))

Autre désignation: RNF207 (RNF207 Produits)

Synonymes: anticorps C1orf188, anticorps D330010C22Rik, anticorps Gm143, anticorps ring finger protein 207, anticorps RNF207, anticorps Rnf207

Sujet: RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.

Poids moléculaire: 71 kDa (MW of target protein)