PIWIL1 anticorps
-
- Antigène Voir toutes PIWIL1 Anticorps
- PIWIL1 (Piwi-Like 1 (PIWIL1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIWIL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
- Top Product
- Discover our top product PIWIL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIWIL1 Blocking Peptide, catalog no. 33R-5494, is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIWIL1 (Piwi-Like 1 (PIWIL1))
- Autre désignation
- PIWIL1 (PIWIL1 Produits)
- Synonymes
- anticorps ziwi, anticorps PIWI, anticorps HIWI, anticorps MIWI, anticorps piwi like RNA-mediated gene silencing 1, anticorps PIWI-like protein 1, anticorps putative PIWI-like protein 1, anticorps putative argonaut-like protein, anticorps piwi-like RNA-mediated gene silencing 1, anticorps PIWIL1, anticorps Tb10.70.5520, anticorps LINJ_21_0470, anticorps LBRM_21_0470, anticorps piwil1, anticorps Piwil1
- Sujet
- PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.
- Poids moléculaire
- 98 kDa (MW of target protein)
-