NR1I3 anticorps (Middle Region)
-
- Antigène Voir toutes NR1I3 Anticorps
- NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NR1I3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NR1 I3 antibody was raised against the middle region of NR1 3
- Purification
- Affinity purified
- Immunogène
- NR1 I3 antibody was raised using the middle region of NR1 3 corresponding to a region with amino acids PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG
- Top Product
- Discover our top product NR1I3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NR1I3 Blocking Peptide, catalog no. 33R-7407, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))
- Autre désignation
- NR1I3 (NR1I3 Produits)
- Synonymes
- anticorps AA209988, anticorps AI551208, anticorps CAR, anticorps CAR-beta, anticorps Care2, anticorps ESTM32, anticorps MB67, anticorps CAR1, anticorps CXR, anticorps nuclear receptor subfamily 1 group I member 3, anticorps nuclear receptor subfamily 1, group I, member 3, anticorps NR1I3, anticorps Nr1i3
- Sujet
- NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-