TUFM anticorps (Middle Region)
-
- Antigène Voir toutes TUFM (Tufm) Anticorps
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TUFM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TUFM antibody was raised against the middle region of TUFM
- Purification
- Affinity purified
- Immunogène
- TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
- Top Product
- Discover our top product Tufm Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
- Autre désignation
- TUFM (Tufm Produits)
- Synonymes
- anticorps TUFM, anticorps D250, anticorps fi06f04, anticorps wu:fi06f04, anticorps zgc:110766, anticorps COXPD4, anticorps EF-TuMT, anticorps EFTU, anticorps P43, anticorps 2300002G02Rik, anticorps C76308, anticorps C76389, anticorps Tu translation elongation factor, mitochondrial, anticorps TUFM, anticorps tufm, anticorps Tufm
- Sujet
- TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.
- Poids moléculaire
- 50 kDa (MW of target protein)
-