PACRG anticorps (Middle Region)
-
- Antigène Voir toutes PACRG Anticorps
- PACRG (PARK2 Co-Regulated (PACRG))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PACRG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PACRG antibody was raised against the middle region of PACRG
- Purification
- Affinity purified
- Immunogène
- PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ
- Top Product
- Discover our top product PACRG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PACRG Blocking Peptide, catalog no. 33R-3157, is also available for use as a blocking control in assays to test for specificity of this PACRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PACRG (PARK2 Co-Regulated (PACRG))
- Autre désignation
- PACRG (PACRG Produits)
- Synonymes
- anticorps PACRG, anticorps GLUP, anticorps HAK005771, anticorps PARK2CRG, anticorps RP3-495O10.2, anticorps zgc:101786, anticorps RGD1561027, anticorps 1700008H23Rik, anticorps parkin coregulated, anticorps PARK2 co-regulated, anticorps PARK2 coregulated, anticorps PACRG, anticorps pacrg, anticorps Pacrg
- Sujet
- PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.
- Poids moléculaire
- 33 kDa (MW of target protein)
-