ZCCHC12 anticorps (N-Term)

N° du produit ABIN631133

Détail du produit anti-ZCCHC12 anticorps

Antigène: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCCHC12 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZCCHC12 antibody was raised against the N terminal of ZCCHC12

Purification: Affinity purified

Immunogène: ZCCHC12 antibody was raised using the N terminal of ZCCHC12 corresponding to a region with amino acids AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZCCHC12 Blocking Peptide, catalog no. 33R-1469, is also available for use as a blocking control in assays to test for specificity of this ZCCHC12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCCHC12

Antigène: ZCCHC12 (Zinc Finger, CCHC Domain Containing 12 (ZCCHC12))

Autre désignation: ZCCHC12 (ZCCHC12 Produits)

Synonymes: anticorps PNMA7A, anticorps SIZN, anticorps SIZN1, anticorps 2810028A01Rik, anticorps AV136720, anticorps Sizn1, anticorps zinc finger CCHC-type containing 12, anticorps sterile alpha motif domain containing 12, anticorps zinc finger, CCHC domain containing 12, anticorps ZCCHC12, anticorps samd12, anticorps Zcchc12

Sujet: ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.

Poids moléculaire: 45 kDa (MW of target protein)