IER5 anticorps (N-Term)

N° du produit ABIN631134

Détail du produit anti-IER5 anticorps

Antigène: IER5 (Immediate Early Response 5 (IER5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IER5 est non-conjugé

Application: Western Blotting (WB)

Specificité: IER5 antibody was raised against the N terminal of IER5

Purification: Affinity purified

Immunogène: IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IER5 Blocking Peptide, catalog no. 33R-5913, is also available for use as a blocking control in assays to test for specificity of this IER5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IER5

Antigène: IER5 (Immediate Early Response 5 (IER5))

Autre désignation: IER5 (IER5 Produits)

Synonymes: anticorps si:dz129i22.1, anticorps wu:fa99a02, anticorps wu:fb04b03, anticorps wu:fb11f08, anticorps zgc:136422, anticorps sbbi48, anticorps MGC83180, anticorps IER5, anticorps SBBI48, anticorps immediate early response 5, anticorps immediate early response 5 L homeolog, anticorps ier5, anticorps ier5.L, anticorps IER5, anticorps Ier5

Sujet: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.

Poids moléculaire: 34 kDa (MW of target protein)