SNAP23 anticorps (N-Term)
-
- Antigène Voir toutes SNAP23 Anticorps
- SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SNAP23 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SNAP23 antibody was raised against the N terminal of SNAP23
- Purification
- Affinity purified
- Immunogène
- SNAP23 antibody was raised using the N terminal of SNAP23 corresponding to a region with amino acids GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC
- Top Product
- Discover our top product SNAP23 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SNAP23 Blocking Peptide, catalog no. 33R-3332, is also available for use as a blocking control in assays to test for specificity of this SNAP23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNAP23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SNAP23 (Synaptosomal-Associated Protein, 23kDa (SNAP23))
- Autre désignation
- SNAP23 (SNAP23 Produits)
- Synonymes
- anticorps 23kDa, anticorps AA408749, anticorps SNAP-23, anticorps Sndt, anticorps Syndet, anticorps HsT17016, anticorps SNAP23A, anticorps SNAP23B, anticorps XOSNAP-23, anticorps snap23-A, anticorps synaptosome associated protein 23, anticorps synaptosome associated protein 23kDa, anticorps synaptosomal-associated protein 23, anticorps synaptosome associated protein 23kDa L homeolog, anticorps SNAP23, anticorps snap23, anticorps Snap23, anticorps snap23.L
- Sujet
- SNAP23 is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this genepecificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin.
- Poids moléculaire
- 23 kDa (MW of target protein)
-