A2BP1 anticorps (N-Term)

N° du produit ABIN631141

Détail du produit anti-A2BP1 anticorps

Antigène: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp A2BP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: A2 BP1 antibody was raised against the N terminal of A2 P1

Purification: Affinity purified

Immunogène: A2 BP1 antibody was raised using the N terminal of A2 P1 corresponding to a region with amino acids NCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

A2BP1 Blocking Peptide, catalog no. 33R-6652, is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur A2BP1

Antigène: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Autre désignation: A2BP1 (A2BP1 Produits)

Synonymes: anticorps A2BP1, anticorps fox1, anticorps a2bp1, anticorps zgc:103635, anticorps 2BP1, anticorps FOX-1, anticorps FOX1, anticorps HRNBP1, anticorps A2bp, anticorps A2bp1, anticorps Hrnbp1, anticorps fox-1, anticorps RNA binding protein, fox-1 homolog 1, anticorps RNA binding fox-1 homolog 1, anticorps multicopper ferroxidase, anticorps RNA binding protein, fox-1 homolog (C. elegans) 1, anticorps RBFOX1, anticorps rbfox1, anticorps FOX1, anticorps Rbfox1

Sujet: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2). Ataxin-2 is the gene product of the SCA2 gene which causes familial neurodegenerative diseases. Ataxin-2 binding protein 1 and ataxin-2 are both localized in the trans-Golgi network. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been found but their full length nature has not been determined.

Poids moléculaire: 40 kDa (MW of target protein)