BRAP anticorps (Middle Region)

N° du produit ABIN631144

Détail du produit anti-BRAP anticorps

Antigène: BRAP (BRCA1 Associated Protein (BRAP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRAP est non-conjugé

Application: Western Blotting (WB)

Specificité: BRAP antibody was raised against the middle region of BRAP

Purification: Affinity purified

Immunogène: BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BRAP Blocking Peptide, catalog no. 33R-10166, is also available for use as a blocking control in assays to test for specificity of this BRAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRAP

Antigène: BRAP (BRCA1 Associated Protein (BRAP))

Autre désignation: BRAP (BRAP Produits)

Synonymes: anticorps imp, anticorps MGC68778, anticorps zgc:92894, anticorps BRAP, anticorps BRAP2, anticorps IMP, anticorps RNF52, anticorps 3010002G07Rik, anticorps BRCA1 associated protein S homeolog, anticorps BRCA1 associated protein, anticorps BRCA1-associated protein, anticorps brca1-associated protein, anticorps brap.S, anticorps brap, anticorps BRAP, anticorps NAEGRDRAFT_81654, anticorps CC1G_00971, anticorps CpipJ_CPIJ003557, anticorps Tsp_05101, anticorps LOC100282389, anticorps Brap

Sujet: The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm.

Poids moléculaire: 67 kDa (MW of target protein)