OGFOD1 anticorps (Middle Region)

N° du produit ABIN631145

Détail du produit anti-OGFOD1 anticorps

Antigène: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OGFOD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: OGFOD1 antibody was raised against the middle region of OGFOD1

Purification: Affinity purified

Immunogène: OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OGFOD1 Blocking Peptide, catalog no. 33R-3184, is also available for use as a blocking control in assays to test for specificity of this OGFOD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGFOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OGFOD1

Antigène: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Autre désignation: OGFOD1 (OGFOD1 Produits)

Synonymes: anticorps tpa1, anticorps MGC145343, anticorps D63, anticorps wu:fc33b08, anticorps zgc:66379, anticorps TPA1, anticorps 4930415J21Rik, anticorps AA387199, anticorps AA939912, anticorps AW061076, anticorps mKIAA1612, anticorps RGD1308848, anticorps 2-oxoglutarate and iron dependent oxygenase domain containing 1, anticorps 2-oxoglutarate and iron-dependent oxygenase domain containing 1, anticorps 2-oxoglutarate and iron dependent oxygenase domain containing 1 L homeolog, anticorps OGFOD1, anticorps ogfod1, anticorps ogfod1.L, anticorps Ogfod1

Sujet: The function of OGFOD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 63 kDa (MW of target protein)