OGFOD1 anticorps (Middle Region)
-
- Antigène Tous les produits OGFOD1
- OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OGFOD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OGFOD1 antibody was raised against the middle region of OGFOD1
- Purification
- Affinity purified
- Immunogène
- OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OGFOD1 Blocking Peptide, catalog no. 33R-3184, is also available for use as a blocking control in assays to test for specificity of this OGFOD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGFOD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))
- Autre désignation
- OGFOD1 (OGFOD1 Produits)
- Synonymes
- anticorps tpa1, anticorps MGC145343, anticorps D63, anticorps wu:fc33b08, anticorps zgc:66379, anticorps TPA1, anticorps 4930415J21Rik, anticorps AA387199, anticorps AA939912, anticorps AW061076, anticorps mKIAA1612, anticorps RGD1308848, anticorps 2-oxoglutarate and iron dependent oxygenase domain containing 1, anticorps 2-oxoglutarate and iron-dependent oxygenase domain containing 1, anticorps 2-oxoglutarate and iron dependent oxygenase domain containing 1 L homeolog, anticorps OGFOD1, anticorps ogfod1, anticorps ogfod1.L, anticorps Ogfod1
- Sujet
- The function of OGFOD1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 63 kDa (MW of target protein)
-